| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic Anhydrase II Mutant (F131V) |
|---|
| Ligand | BDBM12019 |
|---|
| Substrate/Competitor | BDBM11402 |
|---|
| Meas. Tech. | In vitro binding of inhibitor to hCA-II |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| Kd | 3.9±n/a nM |
|---|
| Citation |  Kim, CY; Chandra, PP; Jain, A; Christianson, DW Fluoroaromatic-fluoroaromatic interactions between inhibitors bound in the crystal lattice of human carbonic anhydrase II. J Am Chem Soc123:9620-7 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Carbonic Anhydrase II Mutant (F131V) |
|---|
| Name: | Carbonic Anhydrase II Mutant (F131V) |
|---|
| Synonyms: | CA-II | Carbonate dehydratase II | Carbonic anhydrase C |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29071.47 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 259 |
|---|
| Sequence: | SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILN
NGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLV
HWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPR
GLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMV
DNWRPAQPLKNRQIKASFK
|
|
|
|---|
| BDBM12019 |
|---|
| Name | BDBM12019 |
|---|
| Synonyms: | 2,6-difluoro-SBB | 4-(AMINOSULFONYL)-N-[(2,6-DIFLUOROPHENYL)METHYL]-BENZAMIDE | N-[(2,6-difluorophenyl)methyl]-4-sulfamoylbenzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H12F2N2O3S |
|---|
| Mol. Mass. | 326.318 |
|---|
| SMILES | NS(=O)(=O)c1ccc(cc1)C(=O)NCc1c(F)cccc1F |
|---|
| Structure |  |
|---|
| BDBM11402 |
|---|
| Name | BDBM11402 |
|---|
| Synonyms: | 5-(dimethylamino)naphthalene-1-sulfonamide | dansylamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H14N2O2S |
|---|
| Mol. Mass. | 250.317 |
|---|
| SMILES | CN(C)c1cccc2c(cccc12)S(N)(=O)=O |
|---|
| Structure |  |
|---|
Search and Browse
