Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50005908
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
Temperature298.15±n/a K
IC50 42±n/a nM
Commentsextracted
Citation Chen, JPettit, SFliri, H Cannabinoid-2 agonists US Patent US9670216 Publication Date 6/6/2017
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005908
NameBDBM50005908
Synonyms:CHEMBL3234707 | US9062004, 14 | US9670216, 14 4-Bromo-5-(2-dimethylaminoethylamino)-2-(3,3,5,5-tetramethylcyclohexyl)pyridazin-3-one
TypeSmall organic molecule
Emp. Form.C18H31BrN4O
Mol. Mass.399.369
SMILESCN(C)CCNc1cnn(C2CC(C)(C)CC(C)(C)C2)c(=O)c1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a