Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 2 (CDK2) Mutant (F82H/L83V/H84D/K89T)
LigandBDBM5544
Substrate/CompetitorHistone H1
Meas. Tech.CDK Inhibition Assay
pH7.5±n/a
Temperature303.15±n/a K
IC50 120±n/a nM
Citation Pratt, DJBentley, JJewsbury, PBoyle, FTEndicott, JANoble, ME Dissecting the determinants of cyclin-dependent kinase 2 and cyclin-dependent kinase 4 inhibitor selectivity. J Med Chem49:5470-7 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cyclin-Dependent Kinase 2 (CDK2) Mutant (F82H/L83V/H84D/K89T)
Name:Cyclin-Dependent Kinase 2 (CDK2) Mutant (F82H/L83V/H84D/K89T)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:cyclin A3
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:29930.91
Organism:Homo sapiens (Human)
Description:cyclin A3 is a c-terminal cyclin A fragment encoding residues 171-432.
Residue:261
Sequence:
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHL
AVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRM
EHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSV
IAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK
NSKYHGVSLLNPPETLNLLNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cyclin-Dependent Kinase 2 (CDK2) Mutant (F82H/L83V/H84D/K89T)
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:33862.98
Organism:Homo sapiens (Human)
Description:n/a
Residue:298
Sequence:
MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEHVDQDLKTFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5544
NameBDBM5544
Synonyms:4-{[6-(cyclohexylmethoxy)-9H-purin-2-yl]amino}benzene-1-sulfonamide | 6-Cyclohexylmethoxy-2-(4 -sulfamoylanilino)purine | NU6102
TypeSmall organic molecule
Emp. Form.C18H22N6O3S
Mol. Mass.402.471
SMILESNS(=O)(=O)c1ccc(Nc2nc(OCC3CCCCC3)c3[nH]cnc3n2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Histone H1
Name:Histone H1
Synonyms:n/a
Type:Other Protein Type
Mol. Mass.:358.43
Organism:Bos taurus (bovine)
Description:n/a
Residue:3
Sequence:
n/a