Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEyes absent homolog 3 (EYA3) (ED)
LigandBDBM50342278
Substrate/Competitorn/a
Meas. Tech.Inhibitory Assay
IC50 19200±n/a nM
Citation Hegde, R Use of small molecule inhibitors targeting EYA tyrosine phosphatase US Patent US9725430 Publication Date 8/8/2017
More Info.:Get all data from this article,  Assay Method
 
Eyes absent homolog 3 (EYA3) (ED)
Name:Eyes absent homolog 3 (EYA3) (ED)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:31463.18
Organism:Homo sapiens (Human)
Description:aa 223-510
Residue:288
Sequence:
TNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNM
TSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLT
MEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSS
VGVQGGVDWMRKLAFRYRKVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGT
ALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLYGLGEIFPIENIYSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50342278
NameBDBM50342278
Synonyms:(2-Ethylbenzofuran-3-yl)(4-hydroxyphenyl)methanone | Benzarone | CHEMBL1474963 | US9725430, Compound 1a
TypeSmall organic molecule
Emp. Form.C17H14O3
Mol. Mass.266.2913
SMILESCCc1oc2ccccc2c1C(=O)c1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a