Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450-C17 (CYP17A1)
LigandBDBM330384
Substrate/Competitorn/a
Meas. Tech.Cyp17 Assay
IC50 5.00±n/a nM
Citation Blass, BEAbou-Gharbia, MAChilders, WEIyer, PBoruwa, J Cytochrome P450 inhibitors and their method of use US Patent US9725436 Publication Date 8/8/2017
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450-C17 (CYP17A1)
Name:Cytochrome P450-C17 (CYP17A1)
Synonyms:Cytochrome P450 21 (CYP21)
Type:Protein
Mol. Mass.:57256.42
Organism:Bos taurus (Bovine)
Description:P05185
Residue:509
Sequence:
MWLLLAVFLLTLAYLFWPKTKHSGAKYPRSLPSLPLVGSLPFLPRRGQQHKNFFKLQEKY
GPIYSFRLGSKTTVMIGHHQLAREVLLKKGKEFSGRPKVATLDILSDNQKGIAFADHGAH
WQLHRKLALNAFALFKDGNLKLEKIINQEANVLCDFLATQHGEAIDLSEPLSLAVTNIIS
FICFNFSFKNEDPALKAIQNVNDGILEVLSKEVLLDIFPVLKIFPSKAMEKMKGCVQTRN
ELLNEILEKCQENFSSDSITNLLHILIQAKVNADNNNAGPDQDSKLLSNRHMLATIGDIF
GAGVETTTSVIKWIVAYLLHHPSLKKRIQDDIDQIIGFNRTPTISDRNRLVLLEATIREV
LRIRPVAPTLIPHKAVIDSSIGDLTIDKGTDVVVNLWALHHSEKEWQHPDLFMPERFLDP
TGTQLISPSLSYLPFGAGPRSCVGEMLARQELFLFMSRLLQRFNLEIPDDGKLPSLEGHA
SLVLQIKPFKVKIEVRQAWKEAQAEGSTP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM330384
NameBDBM330384
Synonyms:US9725436, Entry 4
TypeSmall organic molecule
Emp. Form.C24H24ClN3O2S
Mol. Mass.453.984
SMILESCS(=O)(=O)N1CCN(CC1)c1ccc(\C=C\c2cc(Cl)cc(c2)-c2ccncc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a