Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmknk1 high atp
LigandBDBM333386
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
IC50 99.0±n/a nM
Citation Eis, KPühler, FZorn, LScholz, ALienau, PGnoth, MJBömer, UGünther, JFanghänel, JKorr, D Substituted aminoimidazopyridazines US Patent US9730929 Publication Date 8/15/2017  Article
More Info.:Get all data from this article,  Assay Method
 
mknk1 high atp
Name:MAP kinase-interacting serine/threonine-protein kinase 1
Synonyms:MAP Kinase-Interacting Protein Kinase (MNK1) | MAP kinase signal-integrating kinase 1 | MAP kinase-interacting serine/threonine-protein kinase 1 (MnK1) | MAP kinase-interacting serine/threonine-protein kinase MNK1 | MAP-kinase interacting kinase 1 (MNK1) | MAPK signal-integrating kinase 1
Type:Serine/threonine-protein kinase
Mol. Mass.:51342.85
Organism:Homo sapiens (Human)
Description:Q9BUB5
Residue:465
Sequence:
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF
YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPS
GLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMK
LNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPP
FVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAK
QRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM333386
NameBDBM333386
Synonyms:3-{[3-(1-Benzofuran-2- yl)imidazo[1,2-b]pyridazin- 6-yl]oxy}-N-methyl-3- phenylpropan-1-amine | US9730929, Example 7
TypeSmall organic molecule
Emp. Form.C24H22N4O2
Mol. Mass.398.4571
SMILESCN(CCC(O)c1ccccc1)c1ccc2ncc(-c3cc4ccccc4o3)n2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a