Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetB-RAF V600E
LigandBDBM333533
Substrate/Competitorn/a
Meas. Tech.Competition Binding Assay
Kd<250±n/a nM
Citation Abraham, SBhagwat, SSCampbell, BTChao, QFaraoni, RHolladay, MWLai, AGRowbottom, MWSetti, ESprankle, KG RAF kinase modulator compounds and methods of use thereof US Patent US9730937 Publication Date 8/15/2017
More Info.:Get all data from this article,  Assay Method
 
B-RAF V600E
Name:B-RAF V600E
Synonyms:B-Raf (V600E) | B-Raf Protein Kinase Mutant (V600E) | B-Raf proto-oncogene serine/threonine-protein kinase | BRAF (V600E) | BRAF mutant V600E | P15056 | Protein mono-ADP-ribosyltransferase (PARP3) | RAF serine/threonine protein kinase (V600E) | Serine/threonine-protein kinase B-raf (V600E) | Serine/threonine-protein kinase B-raf (V600E) | V-RAF murine sarcoma viral oncogene homologue B1 mutant (BRAF V600E)
Type:n/a
Mol. Mass.:84474.98
Organism:Homo sapiens (Human)
Description:P15056 V600E
Residue:766
Sequence:
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEH
IEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTV
TSSSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRK
TFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPI
PQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQR
DRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSP
GPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDV
AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHH
LHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATE
KSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNIN
NRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS
LPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM333533
NameBDBM333533
Synonyms:1-(5-tert- butylisoxazol- 3-yl)-3-(3- (7-(3-(4- (hydroxylmethyl) piperidin-1- yl)propoxy)- 6-methoxy- quinazolin-4- ylthio)phenyl) urea | US9730937, Example 74
TypeSmall organic molecule
Emp. Form.C32H40N6O5S
Mol. Mass.620.762
SMILESCOc1cc2c(Sc3cccc(NC(=O)Nc4cc(on4)C(C)(C)C)c3)ncnc2cc1OCCCN1CCC(CO)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a