Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 12 (p38MAPgamma)
LigandBDBM334385
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhibition Assay
IC50 172±n/a nM
Citation Frickel, FFyfe, MCMeghani, PThom, SM Kinase inhibitors US Patent US9732063 Publication Date 8/15/2017
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 12 (p38MAPgamma)
Name:p38 delta/gamma
Synonyms:MAP kinase p38 gamma | Mitogen-activated protein kinase 12 (MAPK12 p38 gamma) | Mitogen-activated protein kinase 12 (p38 gamma) | Mitogen-activated protein kinase p38 gamma (p38 MAPKγ)
Type:Protein
Mol. Mass.:41938.69
Organism:Homo sapiens (Human)
Description:P53778
Residue:367
Sequence:
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM334385
NameBDBM334385
Synonyms:1-(3-(tert-Butyl)-1-(p-tolyl)-1H-pyrazol-5-yl)-3-(4-((2-((2-methoxy-6-(2-(2-(2-methoxyethoxy)ethoxy)ethoxy)pyridin-4-yl)amino)pyrimidin-4-yl)oxy)naphthalen-1-yl)urea | US9732063, Example 69
TypeSmall organic molecule
Emp. Form.C42H48N8O7
Mol. Mass.776.8799
SMILESCOCCOCCOCCOc1cc(Nc2nccc(Oc3ccc(NC(=O)Nc4cc(nn4-c4ccc(C)cc4)C(C)(C)C)c4ccccc34)n2)cc(OC)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a