Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine N-methyltransferase 5
LigandBDBM297751
Substrate/Competitorn/a
Meas. Tech.Biochemical Assay
IC50<100±n/a nM
Citation Duncan, KWChesworth, RBoriack-Sjodin, PAMunchhof, MJ PRMT5 inhibitors and uses thereof US Patent US9732072 Publication Date 8/15/2017
More Info.:Get all data from this article,  Assay Method
 
Protein arginine N-methyltransferase 5
Name:Protein arginine N-methyltransferase 5
Synonyms:72 kDa ICln-binding protein | HRMT1L5 | Histone-arginine N-methyltransferase PRMT5 | IBP72 | JBP1 | Jak-binding protein 1 | PRMT5 | PRMT5/MEP50 complex | Protein arginine N-methyltransferase 5 (PRMT5) | Protein arginine methyltransferase 5 (PRMT5) | SKB1 | SKB1 homolog | SKB1Hs | Shk1 kinase-binding protein 1 homolog
Type:Enzyme
Mol. Mass.:72679.99
Organism:Homo sapiens (Human)
Description:O14744
Residue:637
Sequence:
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAK
NRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLP
AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYS
GEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK
KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF
AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV
LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKL
YNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEF
PVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICV
RFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM297751
NameBDBM297751
Synonyms:US10118918, Compound 30 | US9732072, Compound 30
TypeSmall organic molecule
Emp. Form.C22H28N4O3
Mol. Mass.396.4827
SMILESO[C@@H](CNC(=O)c1ccnc(NC2CCOCC2)c1)CN1Cc2ccccc2C1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a