Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase JAK1
LigandBDBM246884
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50<10±n/a nM
Citation Zhou, JQiao, LWeng, L Process for the synthesis of a phosphoinositide 3-kinase inhibitor US Patent US9732097 Publication Date 8/15/2017
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase JAK1
Name:Tyrosine-protein kinase JAK1
Synonyms:JAK-1 | JAK1 | JAK1A | JAK1B | Janus kinase 1 | Janus kinase 1 (JAK1) | Janus kinase 1 JAK1
Type:Protein
Mol. Mass.:133293.73
Organism:Homo sapiens (Human)
Description:P23458
Residue:1154
Sequence:
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM246884
NameBDBM246884
Synonyms:US10053465, 23 | US10065963, Compound 23 | US10125150, Example 23 | US9732097, Example 23 | {trans-3-(4-{[4- ({[(1S)-2-hydroxy-1- methylethyl]amino} methyl)-6- (trifluoromethyl) pyridin-2- yl]oxy}piperidin-1- yl)-1-[4-(7H- pyrrolo[2,3- d]pyrimidin-4-yl)- 1H-pyrazol-1- yl]cyclobutyl} acetonitrile
TypeSmall organic molecule
Emp. Form.C30H34F3N9O2
Mol. Mass.609.6453
SMILESC[C@@H](CO)NCc1cc(OC2CCN(CC2)[C@H]2C[C@@](CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)nc(c1)C(F)(F)F |r,wU:18.24,1.0,wD:16.16,(-2.38,11.91,;-.89,11.51,;.2,12.6,;1.69,12.2,;-.49,10.02,;-1.58,8.93,;-1.18,7.44,;-2.27,6.36,;-1.87,4.87,;-2.96,3.78,;-2.56,2.29,;-3.65,1.2,;-3.25,-.28,;-1.77,-.68,;-.68,.41,;-1.08,1.89,;-1.37,-2.17,;-2.14,-3.5,;-.8,-4.27,;.68,-4.67,;1.77,-3.58,;2.86,-2.49,;-.03,-2.94,;-1.57,-5.61,;-1.1,-7.07,;-2.34,-7.98,;-3.59,-7.07,;-3.11,-5.61,;-2.34,-9.52,;-3.68,-10.29,;-3.68,-11.83,;-2.34,-12.6,;-1.01,-11.83,;.45,-12.3,;1.36,-11.06,;.45,-9.81,;-1.01,-10.29,;-.39,4.47,;.7,5.56,;.3,7.05,;2.19,5.16,;3.28,6.25,;2.59,3.67,;3.68,4.76,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a