Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 4 Bromo 2 domain(BRD4 BD2)
LigandBDBM333407
Substrate/Competitorn/a
Meas. Tech.BRD4 AlphaScreen Assay
IC50<100±n/a nM
Citation Yue, EWCombs, APBuesking, AW Bicyclic heterocycles as bet protein inhibitors US Patent US9737516 Publication Date 8/22/2017
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 4 Bromo 2 domain(BRD4 BD2)
Name:Bromodomain-containing protein 4 Bromo 2 domain(BRD4 BD2)
Synonyms:Bromodomain-containing protein 4 (BD2) | Bromodomain-containing protein 4 Bromodomain 2 (BRD4-2) | Bromodomain-containing protein 4 Domain 2
Type:Protein
Mol. Mass.:8564.63
Organism:Homo sapiens (Human)
Description:BD2 (368-440 aa) of O60885
Residue:73
Sequence:
KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFS
NCYKYNPPDHEVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM333407
NameBDBM333407
Synonyms:4-[6-(2,4-Difluorophenoxy)-1-methyl-1H-benzimidazol-5-yl]-6-methyl-1,6-dihydro-7H-pyrrolo[2,3-c]pyridin-7-one | US9737516, Example 3
TypeSmall organic molecule
Emp. Form.C22H16F2N4O2
Mol. Mass.406.3848
SMILESCn1cnc2cc(c(Oc3ccc(F)cc3F)cc12)-c1cn(C)c(=O)c2[nH]ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a