Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
LigandBDBM333425
Substrate/Competitorn/a
Meas. Tech.BRD4 AlphaScreen Assay
IC50<100±n/a nM
Citation Yue, EWCombs, APBuesking, AW Bicyclic heterocycles as bet protein inhibitors US Patent US9737516 Publication Date 8/22/2017
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
Name:Bromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
Synonyms:Bromodomain-containing protein 4 (BD1) | Bromodomain-containing protein 4 Bromodomain 1 (BRD4-1) | Bromodomain-containing protein 4 Domain 1
Type:n/a
Mol. Mass.:8856.55
Organism:Homo sapiens (Human)
Description:BD1 (75-147 aa) of O60885
Residue:73
Sequence:
WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFT
NCYIYNKPGDDIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM333425
NameBDBM333425
Synonyms:4-[5-(Cyclobutylmethoxy)-2-cyclopentyl-1H-benzimidazol-6-yl]-6-methyl-1,6-dihydro-7H-pyrrolo[2,3-c]pyridin-7-one bis(trifluoroacetate) | US9737516, Example 21
TypeSmall organic molecule
Emp. Form.C25H28N4O2
Mol. Mass.416.5154
SMILESCn1cc(-c2cc3[nH]c(nc3cc2OCC2CCC2)C2CCCC2)c2cc[nH]c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a