Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 4 Bromo 2 domain(BRD4 BD2)
LigandBDBM333426
Substrate/Competitorn/a
Meas. Tech.BRD4 AlphaScreen Assay
IC50<100±n/a nM
Citation Yue, EWCombs, APBuesking, AW Bicyclic heterocycles as bet protein inhibitors US Patent US9737516 Publication Date 8/22/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 4 Bromo 2 domain(BRD4 BD2)
Name:Bromodomain-containing protein 4 Bromo 2 domain(BRD4 BD2)
Synonyms:Bromodomain-containing protein 4 (BD2) | Bromodomain-containing protein 4 Bromodomain 2 (BRD4-2) | Bromodomain-containing protein 4 Domain 2
Type:Protein
Mol. Mass.:8564.63
Organism:Homo sapiens (Human)
Description:BD2 (368-440 aa) of O60885
Residue:73
Sequence:
KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFS
NCYKYNPPDHEVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM333426
NameBDBM333426
Synonyms:Ammonium 3-[5-(cyclobutylmethoxy)-6-(6-methyl-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]pyridin-4-yl)-1H-benzimidazol-2-yl]propanoate | US9737516, Example 22
TypeSmall organic molecule
Emp. Form.C23H23N4O4
Mol. Mass.419.4537
SMILESCn1cc(-c2cc3[nH]c(CCC([O-])=O)nc3cc2OCC2CCC2)c2cc[nH]c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a