Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNAD-dependent deacetylase sirtuin 2
LigandBDBM335555
Substrate/Competitorn/a
Meas. Tech.Biochemical Deacetylation Assay
IC50>50000000±n/a nM
Citation Kazantsev, AGThompson, LMAbagyan, RCasale, M Small molecule activators of NRF2 pathway US Patent US9737525 Publication Date 8/22/2017  Article
More Info.:Get all data from this article,  Assay Method
 
NAD-dependent deacetylase sirtuin 2
Name:NAD-dependent deacetylase sirtuin 2
Synonyms:NAD-Dependent Deacetylase Sirtuin-2 | NAD-dependent deacetylase sirtuin 3 | NAD-dependent protein deacetylase sirtuin-2 (SIRT2) | SIR2-like | SIR2-like protein 2 | SIRT2 | Sirtuin 2 (SIRT2)
Type:Hydrolase
Mol. Mass.:43172.62
Organism:Homo sapiens (Human)
Description:n/a
Residue:389
Sequence:
MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM335555
NameBDBM335555
Synonyms:US9737525, Compound MIND4-17-3
TypeSmall organic molecule
Emp. Form.C14H11N5O3S
Mol. Mass.329.334
SMILES[O-][N+](=O)c1ccc(Sc2nnc(COc3ccccc3)[nH]2)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a