Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAP2-associated protein kinase 1 (AAK1)
LigandBDBM335578
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
IC50 55±n/a nM
Citation Dzierba, CDDasgupta, BMacor, JEBronson, JJRajamani, RKarageorge, GN Pyrrolotriazine kinase inhibitors US Patent US9737542 Publication Date 8/22/2017
More Info.:Get all data from this article,  Assay Method
 
AP2-associated protein kinase 1 (AAK1)
Name:AP2-associated protein kinase 1
Synonyms:AAK1 | Adaptor-associated kinase 1 | KIAA1048
Type:PROTEIN
Mol. Mass.:103884.23
Organism:Homo sapiens (Human)
Description:ChEMBL_774569
Residue:961
Sequence:
MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIV
FLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVW
EVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVE
NILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIIT
TKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDK
RPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTT
ETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPPQAAGSSNQPGLLASVPQPKP
QAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQQLFLKQQQQQQQPPP
AQQQPAGTFYQQQQAQTQQFQAVHPATQKPAIAQFPVVSQGGSQQQLMQNFYQQQQQQQQ
QQQQQQLATALHQQQLMTQQAALQQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQ
PKVQTTPPPAVQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAA
AEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDDDNFSKLTAEELLNKDFAKLG
EGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFI
PLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPV
PQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNL
ISGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLID
L
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM335578
NameBDBM335578
Synonyms:5-((4-aminopiperidin-1-yl)methyl)-N-(3-(5-propyl-1,3,4-thiadiazol-2-yl)phenyl)pyrrolo[2,1-f][1,2,4]triazin-4-amine | US9737542, Example 21
TypeSmall organic molecule
Emp. Form.C23H28N8S
Mol. Mass.448.587
SMILESCCCc1nnc(s1)-c1cccc(Nc2ncnn3ccc(CN4CCC(N)CC4)c23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a