Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP3 subtype
LigandBDBM335703
Substrate/Competitorn/a
Meas. Tech.Radioligand SPA Binding Assay
Ki 48.6±n/a nM
Citation Bahnck, KCanterbury, DEdmonds, DJFutatsugi, KLee, ECMenhaji-Klotz, EPolivkova, JStanton, RV Antagonists of prostaglandin EP3 receptor US Patent US9738626 Publication Date 8/22/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP3 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor, EP3 subtype | PGE2-R | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor
Type:Enzyme
Mol. Mass.:43335.03
Organism:Homo sapiens (Human)
Description:P43115
Residue:390
Sequence:
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM335703
NameBDBM335703
Synonyms:(R)-3-(6-(5-fluoroquinolin-7-yl)-2-hydroxypyridin-3-yl)-3-methylpiperidin-2-one | US9738626, 6 (TFA salt)
TypeSmall organic molecule
Emp. Form.C20H18FN3O2
Mol. Mass.351.3742
SMILESC[C@@]1(CCCNC1=O)c1ccc(nc1O)-c1cc(F)c2cccnc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a