Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Mer
LigandBDBM336466
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50<10±n/a nM
Citation Wang, XLiu, JYang, CZhang, WFrye, SKireev, D Pyrazolopyrimidine compounds for the treatment of cancer US Patent US9744172 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Mer
Name:Tyrosine-protein kinase Mer
Synonyms:MER | MER intracellular domain/EGFR extracellular domain chimera | MERTK | Proto-oncogene c-Mer | Proto-oncogene tyrosine-protein kinase MER | Receptor tyrosine kinase MerTK
Type:PROTEIN
Mol. Mass.:110234.77
Organism:Homo sapiens (Human)
Description:ChEMBL_1498723
Residue:999
Sequence:
MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQ
PALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVP
NIYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKIN
NEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNE
QPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSI
LISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVS
CMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGY
RISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFI
PAHGWVDYAPSSTPAPGNADPVLIIFGCFCGFILIGLILYISLAIRKRVQETKFGNAFTE
EDSELVVNYIAKKSFCRRAIELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGS
VMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMS
SQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFL
HRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSK
SDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTD
PLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPD
SIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGE
RLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM336466
NameBDBM336466
Synonyms:US9744172, Compound UNC1265A
TypeSmall organic molecule
Emp. Form.C30H44N8O4S
Mol. Mass.612.787
SMILESCCCCNc1ncc2c(nn(C3CC[C@H](O)CC3)c2n1)-c1ccc(cc1)S(=O)(=O)NCCC(=O)NC1CCN(C)CC1 |r,wD:15.15,(-9.97,-6.6,;-8.64,-5.83,;-7.3,-6.6,;-5.97,-5.83,;-4.63,-6.6,;-3.3,-5.83,;-3.3,-4.29,;-1.97,-3.52,;-.63,-4.29,;.83,-3.81,;1.74,-5.06,;.83,-6.31,;1.23,-7.79,;2.72,-8.19,;3.12,-9.68,;2.03,-10.77,;2.43,-12.26,;.54,-10.37,;.14,-8.88,;-.63,-5.83,;-1.97,-6.6,;1.23,-2.33,;2.72,-1.93,;3.12,-.44,;2.03,.65,;.54,.25,;.14,-1.24,;2.43,2.14,;.94,2.53,;2.03,3.62,;3.91,2.53,;4.31,4.02,;5.8,4.42,;6.2,5.91,;5.11,7,;7.68,6.31,;8.08,7.79,;9.57,8.19,;9.97,9.68,;8.88,10.77,;9.28,12.26,;7.39,10.37,;6.99,8.88,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a