Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear receptor ROR-gamma
LigandBDBM332425
Substrate/Competitorn/a
Meas. Tech.Biochemical TR-FRET Assay
IC50>10000±n/a nM
Citation Barr, KJBienstock, CEMaclean, JKZhang, HBeresis, RTZhang, DAnthony, NJLapointe, BTTian, Y 4-heteroaryl substituted benzoic acid compounds as RORgammaT inhibitors and uses thereof US Patent US9745265 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
Nuclear receptor ROR-gamma
Name:Nuclear receptor ROR-gamma
Synonyms:Nr1f3 | Nuclear receptor RZR-gamma | Nuclear receptor subfamily 1 group F member 3 | RAR-related orphan receptor C | Retinoid-related orphan receptor-gamma | Rorc | Rorg | TOR | Thor | Thymus orphan receptor
Type:PROTEIN
Mol. Mass.:58133.31
Organism:Mus musculus
Description:ChEMBL_103664
Residue:516
Sequence:
MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
CNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGS
GPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELG
EPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSR
EEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLTAGAMEVVL
VRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTA
LVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEK
LQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM332425
NameBDBM332425
Synonyms:3-fluoro-4-(1- (tetrahydro- furan-2- carbonyl)-1H- indazol-3-yl) benzoic acid | US10196354, Example 1U | US9745265, 1U
TypeSmall organic molecule
Emp. Form.C19H15FN2O4
Mol. Mass.354.3318
SMILESOC(=O)c1ccc(-c2nn(C(=O)C3CCCO3)c3ccccc23)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a