Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 2
LigandBDBM336757
Substrate/Competitorn/a
Meas. Tech.FLIPR Ca2+ Flux Assay
IC50 110±n/a nM
Citation Kuduk, SDSkudlarek, JW 2-pyridyloxy-4-ether orexin receptor antagonists US Patent US9745284 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 2
Name:Orexin receptor type 2
Synonyms:HCRTR2 | Hypocretin receptor type 2 | Orexin receptor type 2 (OR 2) | Orexin receptor type 2 (OR-2) | Orexin receptor type 2 (OX2) | Orexin receptor type 2 (OX2R) | Orexin receptor type 2 (OxR2) | Ox-2-R | Ox2-R
Type:Protein
Mol. Mass.:50710.53
Organism:Homo sapiens (Human)
Description:O43614
Residue:444
Sequence:
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM336757
NameBDBM336757
Synonyms:6-methoxy-3- ({(2R,5R)-5-[(4- methoxypyridin- 2-yl)oxy]-2- methylpyridin-1- yl}carbonyl)-2- (2H-1,2,3-triazol- 2-yl)pyridine | US9745284, 18 | US9745284, 25
TypeSmall organic molecule
Emp. Form.C23H28N6O4
Mol. Mass.452.5062
SMILESCOc1ccc(C(=O)N2C[C@@H](CC[C@H]2C)Oc2cc(OC(C)C)ccn2)c(n1)-n1nccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a