Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 2
LigandBDBM336768
Substrate/Competitorn/a
Meas. Tech.FLIPR Ca2+ Flux Assay
IC50 38.0±n/a nM
Citation Kuduk, SDSkudlarek, JW 2-pyridyloxy-4-ether orexin receptor antagonists US Patent US9745284 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 2
Name:Orexin receptor type 2
Synonyms:HCRTR2 | Hypocretin receptor type 2 | Orexin receptor type 2 (OR 2) | Orexin receptor type 2 (OR-2) | Orexin receptor type 2 (OX2) | Orexin receptor type 2 (OX2R) | Orexin receptor type 2 (OxR2) | Ox-2-R | Ox2-R
Type:Protein
Mol. Mass.:50710.53
Organism:Homo sapiens (Human)
Description:O43614
Residue:444
Sequence:
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM336768
NameBDBM336768
Synonyms:2-{[(3R,6R)-6-methyl-1-{[2- (2H-tetrazol-2- yl)phenyl]carbonyl}piperidin- 3-yl]oxy}-4-(2,2,2- trifluoroethoxy)pyridine | US9745284, 30
TypeSmall organic molecule
Emp. Form.C21H21F3N6O3
Mol. Mass.462.425
SMILESC[C@@H]1CC[C@H](CN1C(=O)c1ccccc1-n1ncnn1)Oc1cc(OCC(F)(F)F)ccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a