Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 1
LigandBDBM336787
Substrate/Competitorn/a
Meas. Tech.FLIPR Ca2+ Flux Assay
IC50 976±n/a nM
Citation Kuduk, SDSkudlarek, JW 2-pyridyloxy-4-ether orexin receptor antagonists US Patent US9745284 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 1
Name:Orexin receptor type 1
Synonyms:Hypocretin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r
Type:Protein
Mol. Mass.:47554.50
Organism:Homo sapiens (Human)
Description:O43613
Residue:425
Sequence:
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM336787
NameBDBM336787
Synonyms:1-(4-methoxy-2- {[(3R,6R)-6- methyl-1-{[2-(2H- 1,2,3-triazol-2- yl)phenyl]carbonyl} piperidin-3- yl]oxy}pyridin- 3-yl)ethanone | US9745284, 51
TypeSmall organic molecule
Emp. Form.C23H25N5O4
Mol. Mass.435.4757
SMILESCOc1ccnc(O[C@@H]2CC[C@@H](C)N(C2)C(=O)c2ccccc2-n2nccn2)c1C(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a