Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 1
LigandBDBM336796
Substrate/Competitorn/a
Meas. Tech.FLIPR Ca2+ Flux Assay
IC50 2017±n/a nM
Citation Kuduk, SDSkudlarek, JW 2-pyridyloxy-4-ether orexin receptor antagonists US Patent US9745284 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 1
Name:Orexin receptor type 1
Synonyms:Hypocretin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r
Type:Protein
Mol. Mass.:47554.50
Organism:Homo sapiens (Human)
Description:O43613
Residue:425
Sequence:
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM336796
NameBDBM336796
Synonyms:(2-(2H-1,2,3-Triazol-2-yl)thiophen-3-yl)((2R,5R)-5-((4-(2,2-difluoroethoxy)pyridin-2-yl)oxy)-2-methylpiperidin-1-yl)methanone | US9745284, 60
TypeSmall organic molecule
Emp. Form.C20H21F2N5O3S
Mol. Mass.449.474
SMILESC[C@@H]1CC[C@H](CN1C(=O)c1ccsc1-n1nccn1)Oc1cc(OCC(F)F)ccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a