Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B1
LigandBDBM336918
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 8500±n/a nM
Citation Hornberger, KRMeyers, KMNemoto, PASurprenant, SYu, H Aldosterone synthase inhibitors US Patent US9745289 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B1
Name:Cytochrome P450 11B1
Synonyms:CYPXIB1 | Cytochrome P450 11B, mitochondrial precursor | Cytochrome P450 11B1 | Cytochrome P450 11B1 (CYP11B1)
Type:Enzyme
Mol. Mass.:57591.44
Organism:Homo sapiens (Human)
Description:P15538
Residue:503
Sequence:
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSMFPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM336918
NameBDBM336918
Synonyms:US9745289, Compound 47A | US9745289, Compound 47B
TypeSmall organic molecule
Emp. Form.C19H20N2O5
Mol. Mass.356.3725
SMILESNC(=O)c1cccc2OC(COc12)c1cncc(OC2CCOCC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a