Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1)
LigandBDBM337239
Substrate/Competitorn/a
Meas. Tech.Kinase High ATP Assay
IC50 10.00±n/a nM
Citation Zorn, LEis, KSchulze, VSülzle, DPuehler, FLienau, PBömer, UPetersen, KHägebarth, A Amidoimidazopyridazines as MKNK-1 kinase inhibitors US Patent US9745304 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1)
Name:MAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:48837.99
Organism:Homo sapiens (Human)
Description:aa: 1-424 and T344D
Residue:442
Sequence:
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF
YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPS
GLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMK
LNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPP
FVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAK
QRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
AEEPEALADGLCSMKLSPPCKS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM337239
NameBDBM337239
Synonyms:N-[3-(1-Benzofuran-2-yl)imidazo[1,2-b]pyridazin-6-yl]-2-(3-fluorophenyl)-acetamide | US9745304, Example 8
TypeSmall organic molecule
Emp. Form.C22H15FN4O2
Mol. Mass.386.3785
SMILESFc1cccc(CC(=O)Nc2ccc3ncc(-c4cc5ccccc5o4)n3n2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a