Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 1
LigandBDBM337293
Substrate/Competitorn/a
Meas. Tech.IMAP-FP assay
IC50 25.0±n/a nM
Citation Lim, JHuang, XFerguson, RDZhou, WBoyce, CWSiliphaivanh, PWitter, DJMaletic, MMKozlowski, JAWilson, KJ Compounds that are ERK inhibitors US Patent US9745307 Publication Date 8/29/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 1
Name:Mitogen-activated protein kinase 1
Synonyms:ERK2 | ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK-2) | Extracellular signal-regulated kinase 2 (ERK2) | MAP Kinase 2/ERK2 | MAPK 2 | MAPK1 | Mitogen activated kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK2) | Mitogen-activated protein kinase 2 | p42-MAPK
Type:Ser/Thr Protein Kinase
Mol. Mass.:41392.76
Organism:Homo sapiens (Human)
Description:P28482
Residue:360
Sequence:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM337293
NameBDBM337293
Synonyms:6-((R)-1-phenylethyl)-3-(((S)-1,1,1-trifluoropropan-2-yl)amino)-5,6-dihydro-1H-pyrazolo[4,3-g]quinazolin-7(8H)-one and (R)-6-(1-phenylethyl)-5,6-dihydro-1H-pyrazolo[4,3-g]-quinazolin-7(8H)-one | US9745307, Example 30
TypeSmall organic molecule
Emp. Form.C20H22F3N5O
Mol. Mass.405.4168
SMILESC[C@H](NC(=N)c1cc2CN([C@H](C)c3ccccc3)C(=O)Nc2cc1N)C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a