Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 1
LigandBDBM272793
Substrate/Competitorn/a
Meas. Tech.IMAP-FP assay
IC50 0.400±n/a nM
Citation Lim, JHuang, XFerguson, RDZhou, WBoyce, CWSiliphaivanh, PWitter, DJMaletic, MMKozlowski, JAWilson, KJ Compounds that are ERK inhibitors US Patent US9745307 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 1
Name:Mitogen-activated protein kinase 1
Synonyms:ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK2) | MAP kinase 1 | MAP kinase 2 | MAP kinase ERK2 | MAPK 1 | MAPK 2 | Mitogen-activated protein kinase 2 | p42 | p42-MAPK
Type:Protein
Mol. Mass.:41278.65
Organism:Mus musculus (Mouse)
Description:P63085
Residue:358
Sequence:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM272793
NameBDBM272793
Synonyms:3-(2-methylpyridin-4-yl)-1,8-dihydro-7H-pyrazolo[4,3-g]quinolin-7-one | US10065967, Example 1 | US9745307, Example 1
TypeSmall organic molecule
Emp. Form.C16H12N4O
Mol. Mass.276.2927
SMILESCc1cc(ccn1)-c1n[nH]c2cc3[nH]c(=O)ccc3cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a