Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D1 receptor
LigandBDBM337366
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Ki 14.0±n/a nM
Citation Gray, DLZhang, LBrodney, MADavoren, JEEfremov, IVGreen, MEO Neil, SVRogers, BN Heterocyclic compounds and their use as dopamine D1 ligands US Patent US9745317 Publication Date 8/29/2017
More Info.:Get all data from this article,  Assay Method
 
Dopamine D1 receptor
Name:Dopamine D1 and D2 receptor
Synonyms:DA D1 receptor | DOPAMINE D1 | DRD1 | Dopamine D1 receptor | Dopamine D1 receptor (D1R) | Dopamine D1A
Type:Enzyme
Mol. Mass.:49303.43
Organism:Homo sapiens (Human)
Description:P21728
Residue:446
Sequence:
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM337366
NameBDBM337366
Synonyms:5-[4-(2,3-Dihydro-1H-pyrrolo[3,2-c]pyridin-4-yloxy)phenyl]-4,6-dimethylpyridazin-3(2H)-one (4) | US9745317, 4
TypeSmall organic molecule
Emp. Form.C43H40N4O3
Mol. Mass.660.8027
SMILESCc1nn(C2CCCCO2)c(=O)c(C)c1-c1ccc(Oc2nccc3N(CCc23)C(c2ccccc2)(c2ccccc2)c2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a