Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-amino-acid oxidase (DAAO)
LigandBDBM337630
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50 61.0±n/a nM
Citation Farnaby, WFieldhouse, CHazel, KKerr, CKinsella, NLivermore, DMerchant, KMiller, D Pyridazinones as DAAO enzyme inhibitors US Patent US9750748 Publication Date 9/5/2017
More Info.:Get all data from this article,  Assay Method
 
D-amino-acid oxidase (DAAO)
Name:D-amino-acid oxidase
Synonyms:D-amino-acid oxidase (DAAO) | DAAO | DAMOX | DAO
Type:Homodimer
Mol. Mass.:39476.06
Organism:Homo sapiens (Human)
Description:n/a
Residue:347
Sequence:
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM337630
NameBDBM337630
Synonyms:4-Hydroxy-6-(3-methylbutyl)pyridazin-3(2H)-one | US9750748, 2
TypeSmall organic molecule
Emp. Form.C9H14N2O2
Mol. Mass.182.2197
SMILESCC(C)CCc1cc(O)c(=O)[nH]n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a