Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase SYK
LigandBDBM298380
Substrate/Competitorn/a
Meas. Tech.GSK 3α Enzyme Inhibition
IC50 187±n/a nM
Citation Baker, TMFyfe, MCJones, GThom, SM Kinase inhibitors US Patent US9751837 Publication Date 9/5/2017
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase SYK
Name:Tyrosine-protein kinase SYK
Synonyms:Lysyl-tRNA synthetase | SYK | Spleen Tyrosine Kinase | Spleen tyrosine kinase (SYK) | Tyrosine-protein kinase SYK (Syk)
Type:Enzyme
Mol. Mass.:72079.99
Organism:Homo sapiens (Human)
Description:P43405
Residue:635
Sequence:
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM298380
NameBDBM298380
Synonyms:4-((4-((4-(3-(5-(tert-Butyl)-2-methoxy-3-(methylsulfonamido)phenyl)ureido)naphthalen-1-yl)oxy)pyridin-2-yl)amino)-2-methoxy-N-(2-(2-(2-methoxyethoxy)ethoxy)ethyl)benzamide | US10125100, Example 5 | US9751837, Example 5
TypeSmall organic molecule
Emp. Form.C43H52N6O10S
Mol. Mass.844.972
SMILESCOCCOCCOCCNC(=O)c1ccc(Nc2cc(Oc3ccc(NC(=O)Nc4cc(cc(NS(C)(=O)=O)c4OC)C(C)(C)C)c4ccccc34)ccn2)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a