Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease Mutant V6(54)
LigandBDBM518
Substrate/CompetitorHIV Protease Chromogenic Peptide Substrate
Meas. Tech.Protease Inhibition Assay
pH4.7±n/a
Temperature310.15±n/a K
Ki 23±2 nM
Km49000±7000 nM
Commentskcat/Km=0.34 +/- 0.06 uM-1sec-1
Citation Clemente, JCMoose, REHemrajani, RWhitford, LRGovindasamy, LReutzel, RMcKenna, RAgbandje-McKenna, MGoodenow, MMDunn, BM Comparing the accumulation of active- and nonactive-site mutations in the HIV-1 protease. Biochemistry43:12141-51 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease Mutant V6(54)
Name:HIV-1 Protease Mutant V6(54)
Synonyms:HIV-1 protease mutant (K20R V32I L33F M36I I54V L63P A71V V82A L90M)
Type:Protein Complex
Mol. Mass.:n/a
Description:The post-ritonavir therapy protease variant plus I54V mutation, which was created by site-directed mutagenesis.
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant V6(54) chain A
Synonyms:HIV-1 Protease Mutant V6(54) chain B
Type:Enzyme Subunit
Mol. Mass.:10827.15
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant V6(54) chain A
Synonyms:HIV-1 Protease Mutant V6(54) chain B
Type:Enzyme Subunit
Mol. Mass.:10827.15
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM518
NameBDBM518
Synonyms:(3S,4aS,8aS)-N-tert-butyl-2-[(2R,3R)-2-hydroxy-3-[(3-hydroxy-2-methylphenyl)formamido]-4-(phenylsulfanyl)butyl]-decahydroisoquinoline-3-carboxamide | AG-1343 | CHEMBL584 | Nelfinavir | Viracept
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
HIV Protease Chromogenic Peptide Substrate
Name:HIV Protease Chromogenic Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1420.11
Organism:n/a
Description:n/a
Residue:13
Sequence:
K-A-R-V-L*Nph-E-A-nL-G