Reaction Details |
 | Report a problem with these data |
Target | Trypsin |
---|
Ligand | BDBM13937 |
---|
Substrate/Competitor | BDBM13790 |
---|
Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
---|
pH | 8±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 65±n/a nM |
---|
Citation | Katz, BA; Elrod, K; Luong, C; Rice, MJ; Mackman, RL; Sprengeler, PA; Spencer, J; Hataye, J; Janc, J; Link, J; Litvak, J; Rai, R; Rice, K; Sideris, S; Verner, E; Young, W A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site. J Mol Biol307:1451-86 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Trypsin |
---|
Name: | Trypsin I |
Synonyms: | Beta-Trypsin | Cationic trypsin | Trypsin I |
Type: | Enzyme |
Mol. Mass.: | 25790.52 |
Organism: | Bos taurus (bovine) |
Description: | P00760 |
Residue: | 246 |
Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
BDBM13937 |
---|
Name | BDBM13937 |
Synonyms: | 2-(2-HYDROXY-PHENYL)-1H-BENZOIMIDAZOLE-5-CARBOXAMIDINE | APC-1144 | {amino[2-(2-hydroxyphenyl)-1H-1,3-benzodiazol-5-yl]methylidene}azanium |
Type | Small organic molecule |
Emp. Form. | C14H13N4O |
Mol. Mass. | 253.2787 |
SMILES | NC(=[NH2+])c1ccc2nc([nH]c2c1)-c1ccccc1O |
Structure |  |
BDBM13790 |
---|
Name | BDBM13790 |
Synonyms: | 6-amino-2-[(1-{2-[(4-methylbenzene)sulfonamido]acetyl}pyrrolidin-2-yl)formamido]-N-(4-nitrophenyl)hexanamide; acetic acid | Chromogenic Substrate | Chromozym-PL | Tosyl-Gly-Pro-Lys-pNA | Tosyl-glycyl-polyl-lysine-4-nitranilide-acetate | Trypsin/Thrombin Chromogenic Substrate | Trypsin/Thrombin/Plasmin Chromogenic Substrate | Trypsin/Thrombin/Tryptase Chromogenic Substrate |
Type | Small Organic Molecule |
Emp. Form. | C26H34N6O7S |
Mol. Mass. | 574.649 |
SMILES | Cc1ccc(cc1)S(=O)(=O)NCC(=O)N1CCCC1C(=O)NC(CCCCN)C(=O)Nc1ccc(cc1)[N+]([O-])=O |
Structure |  |