Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinaldehyde-binding protein 1
LigandBDBM338928
Substrate/Competitorn/a
Meas. Tech.Isomerase Assay
IC50<1000±n/a nM
Citation Scott, ILKuksa, VAGall, AOrme, MWGage, JLittle, Jr., TLJiang, QRossiter, LMMcGee, Jr., KFKubota, R Styrenyl derivative compounds for treating ophthalmic diseases and disorders US Patent US10201545 Publication Date 2/12/2019
More Info.:Get all data from this article,  Assay Method
 
Retinaldehyde-binding protein 1
Name:Retinaldehyde-binding protein 1
Synonyms:CRALBP | Cellular retinaldehyde-binding protein | RLBP1
Type:Enzyme Catalytic Domain
Mol. Mass.:36462.25
Organism:Homo sapiens (Human)
Description:P12271
Residue:317
Sequence:
MSEGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETRE
EAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNF
RLQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAY
CFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKAIHF
IHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKA
VAEQLFGPQAQAENTAF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM338928
NameBDBM338928
Synonyms:(E)-3-amino-1-(3-(2,6-dichlorostyryl)phenyl)propan-1- | US10201545, Compound 50
TypeSmall organic molecule
Emp. Form.C17H17Cl2NO
Mol. Mass.322.229
SMILESNCCC(O)c1cccc(\C=C\c2c(Cl)cccc2Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a