Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear receptor ROR-gamma
LigandBDBM339345
Substrate/Competitorn/a
Meas. Tech.RORgammat (LBD) Reporter Assay
IC50 21.0±n/a nM
Citation Leonard, KABarbay, KEdwards, JPKreutter, KDKummer, DAMaharoof, UNishimura, RUrbanski, MVenkatesan, HWang, AWolin, RLWoods, CRFourie, AXue, XCummings, MDMcClure, KTanis, V Quinolinyl modulators of RORγt US Patent US10201546 Publication Date 2/12/2019
More Info.:Get all data from this article,  Assay Method
 
Nuclear receptor ROR-gamma
Name:Nuclear receptor ROR-gamma
Synonyms:NR1F3 | Nuclear receptor subfamily 1 group F member 3 | RAR-related orphan receptor C (RORc) | RORC | RORG | RZRG | Retinoid-related orphan receptor-gamma | Retinoid-related orphan receptor-gamma (RORc)
Type:Protein
Mol. Mass.:58218.40
Organism:Homo sapiens (Human)
Description:P51449
Residue:518
Sequence:
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQR
CNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
GSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPG
LGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIF
SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV
VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY
TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHV
ERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM339345
NameBDBM339345
Synonyms:US10201546, Example 205c
TypeSmall organic molecule
Emp. Form.C30H28ClF6N5O
Mol. Mass.624.02
SMILESCn1cncc1[C@](O)(c1ccnc(c1)C(F)(F)F)c1ccc2nc(C3CC3)c(CN3CCC(CC3)C(F)(F)F)c(Cl)c2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a