Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIDH2(R140Q)
LigandBDBM339562
Substrate/Competitorn/a
Meas. Tech.IDH2 Enzymatic Assay
IC50 550±n/a nM
Citation Popovici-Muller, JSalituro, FGSaunders, JOTravins, JYan, S Therapeutic compounds and compositions US Patent US10202339 Publication Date 2/12/2019
More Info.:Get all data from this article,  Assay Method
 
IDH2(R140Q)
Name:IDH2(R140Q)
Synonyms:idh2 r140q
Type:Enzyme Catalytic Domain
Mol. Mass.:50823.17
Organism:Homo sapiens (Human)
Description:n/a
Residue:452
Sequence:
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTR
IIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDE
ARVEEFKLKKMWKSPNGTIGNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYK
ATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAI
QKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQK
GRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM339562
NameBDBM339562
Synonyms:US10202339, Compound 6
TypeSmall organic molecule
Emp. Form.C24H21N3O4S2
Mol. Mass.479.571
SMILESCOc1ccccc1NC(=O)Nc1cc(ccc1-c1ccsc1)S(=O)(=O)Nc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a