Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor 4
LigandBDBM339866
Substrate/Competitorn/a
Meas. Tech.FGFR4 (Enzymatic Assay)
IC50 6.31±n/a nM
Citation Angibaud, PRObringer, MMarin, JJJeanty, M Naphthyridine derivative compounds US Patent US9757364 Publication Date 9/12/2017
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor 4
Name:Fibroblast growth factor receptor
Synonyms:CD_antigen: CD334 FGFR4 | FGFR-4 | Fibroblast growth factor receptor 4 (FGFR4) | JK2 | TKF
Type:Protein
Mol. Mass.:87957.45
Organism:Homo sapiens (Human)
Description:P22455
Residue:802
Sequence:
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM339866
NameBDBM339866
Synonyms:US9757364, Compound 58
TypeSmall organic molecule
Emp. Form.C24H21FN6O3
Mol. Mass.460.4603
SMILESCOc1cc(OC)c(F)c(c1)N(Cc1ncco1)c1ccc2ncc(cc2n1)-c1cnn(C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a