Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCoagulation factor XI
LigandBDBM339908
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 195±n/a nM
Citation Ikuma, YFukuda, NIwata, MKimura, HSuzuki, K 1-(cycloalkyl-carbonyl)proline derivative US Patent US9758480 Publication Date 9/12/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Coagulation factor XI
Name:Coagulation factor XI
Synonyms:Coagulation factor XIa | Coagulation factor XIa heavy chain | Coagulation factor XIa light chain | F11 | FXI | Factor XIa | Factor XIa (fXIa) | PTA | Plasma thromboplastin antecedent
Type:Enzyme
Mol. Mass.:70130.58
Organism:Homo sapiens (Human)
Description:P03951
Residue:625
Sequence:
MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFT
FTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDM
KGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITK
LDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFT
FFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTD
FLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKIL
HGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI
IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYD
IALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLV
TNEECQKRYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCA
QRERPGVYTNVVEYVDWILEKTQAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM339908
NameBDBM339908
Synonyms:4-Methoxybutyl 5-({(3S)-1-[(trans-4-{(1S)-1-[(tert-butoxycarbonyl)amino]-2-fluoroethyl}cyclohexyl)carbonyl]-3-cyclohexyl-L-prolyl}amino)-1-benzofuran-2-carboxylate | US9758480, 130
TypeSmall organic molecule
Emp. Form.C29H38FN3O4S
Mol. Mass.543.693
SMILESN[C@H](CF)[C@H]1CC[C@@H](CC1)C(=O)N1CC[C@@H]([C@H]1C(=O)Nc1ccc2sc(cc2c1)C(O)=O)C1CCCCC1 |r,wU:15.35,4.3,wD:7.10,16.18,1.0,(4.65,-39.21,;3.18,-38.73,;2.04,-39.76,;2.36,-41.27,;2.86,-37.22,;1.4,-36.75,;1.08,-35.24,;2.22,-34.21,;3.69,-34.69,;4.01,-36.19,;1.9,-32.7,;.44,-32.23,;3.05,-31.67,;4.55,-31.99,;5.32,-30.66,;4.29,-29.52,;2.89,-30.14,;1.55,-29.37,;1.55,-27.83,;.22,-30.14,;-1.12,-29.37,;-1.12,-27.83,;-2.45,-27.06,;-3.78,-27.83,;-5.25,-27.36,;-6.15,-28.6,;-5.25,-29.85,;-3.78,-29.37,;-2.45,-30.14,;-7.69,-28.6,;-8.46,-27.27,;-8.46,-29.94,;4.61,-28.01,;3.47,-26.98,;3.79,-25.47,;5.25,-25,;6.4,-26.03,;6.08,-27.53,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a