Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4C (JMJD2C)
LigandBDBM340044
Substrate/Competitorn/a
Meas. Tech.In Vitro Enzyme Inhibition Assay
IC50 5500±n/a nM
Citation Chen, YKWallace, MB Histone demethylase inhibitors US Patent US9758517 Publication Date 9/12/2017
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4C (JMJD2C)
Name:Lysine-specific demethylase 4C
Synonyms:GASC-1 protein | GASC1 | Gene amplified in squamous cell carcinoma 1 protein | JHDM3C | JMJD2C | JmjC domain-containing histone demethylation protein 3C | Jumonji domain-containing protein 2C | KDM4C | KIAA0780
Type:Protein
Mol. Mass.:119979.01
Organism:Homo sapiens (Human)
Description:Q9H3R0
Residue:1056
Sequence:
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM340044
NameBDBM340044
Synonyms:2-[2-Methyl-5-(trifluoromethoxy)-2H-indazol-3-yl]-1H-pyrrolo[3,2-b]pyridine-7-carboxylic acid | US9758517, Example 5
TypeSmall organic molecule
Emp. Form.C17H11F3N4O3
Mol. Mass.376.2894
SMILESCn1nc2ccc(OC(F)(F)F)cc2c1-c1cc2nccc(C(O)=O)c2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a