Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFactor D
LigandBDBM340209
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 5500±n/a nM
Citation Wiles, JAPhadke, ASWang, XChen, DHashimoto, AGadhachanda, VRPais, GWang, QAgarwal, ADeshpande, M Compounds for treatment of complement mediated disorders US Patent US9758537 Publication Date 9/12/2017
More Info.:Get all data from this article,  Assay Method
 
Factor D
Name:Complement factor D
Synonyms:Adipsin | C3 convertase activator | CFD | Complement Factor D | DF | PFD | Properdin factor D
Type:Protein
Mol. Mass.:27039.19
Organism:Homo sapiens (Human)
Description:P00746
Residue:253
Sequence:
MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM340209
NameBDBM340209
Synonyms:3-((2S,4R)-2-(5-(6- bromopyridin-2-yl)-1H- imidazol-2-yl)-4- fluoropyrrolidine-1- carboxamido)-1H- indole-1-carboxamide | US9758537, Compound 12
TypeSmall organic molecule
Emp. Form.C23H20BrFN6O2
Mol. Mass.511.346
SMILESCC(=O)n1cc(NC(=O)N2C[C@H](F)C[C@H]2c2ncc([nH]2)-c2cccc(Br)n2)c2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a