Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFactor D
LigandBDBM340288
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50<1000±n/a nM
Citation Wiles, JAPhadke, ASWang, XChen, DHashimoto, AGadhachanda, VRPais, GWang, QAgarwal, ADeshpande, M Compounds for treatment of complement mediated disorders US Patent US9758537 Publication Date 9/12/2017
More Info.:Get all data from this article,  Assay Method
 
Factor D
Name:Complement factor D
Synonyms:Adipsin | C3 convertase activator | CFD | Complement Factor D | DF | PFD | Properdin factor D
Type:Protein
Mol. Mass.:27039.19
Organism:Homo sapiens (Human)
Description:P00746
Residue:253
Sequence:
MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM340288
NameBDBM340288
Synonyms:(2S,4R)-1-(2-(3-acetyl- 4-cyano-1H-indol-1- yl)acetyl)-N-(2'-chloro- 2-fluorobiphenyl-3-yl)- 4-fluoropyrrolidine-2- carboxamide | US9758537, Compound 97
TypeSmall organic molecule
Emp. Form.C30H23ClF2N4O3
Mol. Mass.560.978
SMILESCC(=O)c1cn(CC(=O)N2C[C@H](F)C[C@H]2C(=O)Nc2cccc(c2F)-c2ccccc2Cl)c2cccc(C#N)c12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a