Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM14152
Substrate/CompetitorBDBM13790
Meas. Tech.Enzyme Assay and Determination of the Inhibition Constants
Ki 230±n/a nM
Citation Katz, BASprengeler, PALuong, CVerner, EElrod, KKirtley, MJanc, JSpencer, JRBreitenbucher, JGHui, HMcGee, DAllen, DMartelli, AMackman, RL Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets. Chem Biol8:1107-21 (2001) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Trypsin
Name:Trypsin I
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14152
NameBDBM14152
Synonyms:6-CHLORO-2-(2-HYDROXY-BIPHENYL-3-YL)-1H-INDOLE-5-CARBOXAMIDINE | APC-10302 | CA-14 | CRA-10302 | {amino[6-chloro-2-(2-hydroxy-3-phenylphenyl)-1H-indol-5-yl]methylidene}azanium
TypeSmall organic molecule
Emp. Form.C21H17ClN3O
Mol. Mass.362.832
SMILESNC(=[NH2+])c1cc2cc([nH]c2cc1Cl)-c1cccc(-c2ccccc2)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM13790
NameBDBM13790
Synonyms:6-amino-2-[(1-{2-[(4-methylbenzene)sulfonamido]acetyl}pyrrolidin-2-yl)formamido]-N-(4-nitrophenyl)hexanamide; acetic acid | Chromogenic Substrate | Chromozym-PL | Tosyl-Gly-Pro-Lys-pNA | Tosyl-glycyl-polyl-lysine-4-nitranilide-acetate | Trypsin/Thrombin Chromogenic Substrate | Trypsin/Thrombin/Plasmin Chromogenic Substrate | Trypsin/Thrombin/Tryptase Chromogenic Substrate
TypeSmall Organic Molecule
Emp. Form.C26H34N6O7S
Mol. Mass.574.649
SMILESCc1ccc(cc1)S(=O)(=O)NCC(=O)N1CCCC1C(=O)NC(CCCCN)C(=O)Nc1ccc(cc1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: