Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAtaxin-1
LigandBDBM321926
Substrate/Competitorn/a
Meas. Tech.Biological Assay
IC50 354±n/a nM
Citation Beattie, DBaettig, ULegrand, DMLister, ASMcKenna, JPearce, DWSandham, DASteward, ORThomson, C Autotaxin inhibitors US Patent US9763957 Publication Date 9/19/2017
More Info.:Get all data from this article,  Assay Method
 
Ataxin-1
Name:Ataxin-1
Synonyms:n/a
Type:Protein
Mol. Mass.:86941.25
Organism:Homo sapiens (Human)
Description:n/a
Residue:815
Sequence:
MKSNQERSNECLPPKKREIPATSRSSEEKAPTLPSDNHRVEGTAWLPGNPGGRGHGGGRH
GPAGTSVELGLQQGIGLHKALSTGLDYSPPSAPRSVPVATTLPAAYATPQPGTPVSPVQY
AHLPHTFQFIGSSQYSGTYASFIPSQLIPPTANPVTSAVASAAGATTPSQRSQLEAYSTL
LANMGSLSQTPGHKAEQQQQQQQQQQQQHQHQQQQQQQQQQQQQQHLSRAPGLITPGSPP
PAQQNQYVHISSSPQNTGRTASPPAIPVHLHPHQTMIPHTLTLGPPSQVVMQYADSGSHF
VPREATKKAESSRLQQAIQAKEVLNGEMEKSRRYGAPSSADLGLGKAGGKSVPHPYESRH
VVVHPSPSDYSSRDPSGVRASVMVLPNSNTPAADLEVQQATHREASPSTLNDKSGLHLGK
PGHRSYALSPHTVIQTTHSASEPLPVGLPATAFYAGTQPPVIGYLSGQQQAITYAGSLPQ
HLVIPGTQPLLIPVGSTDMEASGAAPAIVTSSPQFAAVPHTFVTTALPKSENFNPEALVT
QAAYPAMVQAQIHLPVVQSVASPAAAPPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQ
SAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSC
CPERTSQLFDLPCSKLSVGDVCISLTLKNLKNGSVKKGQPVDPASVLLKHSKADGLAGSR
HRYAEQENGINQGSAQMLSENGELKFPEKMGLPAAPFLTKIEPSKPAATRKRRWSAPESR
KLEKSEDEPPLTLPKPSLIPQEVKICIEGRSNVGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM321926
NameBDBM321926
Synonyms:(E)-1-(3-(4-Chloro-2-((5-methyl-2H-tetrazol-2-yl)methyl)phenyl)acryloyl)piperidine-3-carboxamide | US10183025, Example 49.8 | US9763957, Example 49.8
TypeSmall organic molecule
Emp. Form.C18H21ClN6O2
Mol. Mass.388.851
SMILESCc1nnn(Cc2cc(Cl)ccc2\C=C\C(=O)N2CCCC(C2)C(N)=O)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a