Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalmodulin-domain protein kinase 1 (CDPK1)
LigandBDBM50345738
Substrate/Competitorn/a
Meas. Tech.Biological Assay
IC50 5.00±n/a nM
Citation Van Voorhis, WCHol, WGLarson, ETMaly, DJMerritt, EOjo, KK Compositions and methods for treating toxoplasmosis, cryptosporidiosis, and other apicomplexan protozoan related diseases US Patent US9765037 Publication Date 9/19/2017
More Info.:Get all data from this article,  Assay Method
 
Calmodulin-domain protein kinase 1 (CDPK1)
Name:Calmodulin-domain protein kinase 1 (CDPK1)
Synonyms:Calmodulin-domain protein kinase 1 | Calmodulin-domain protein kinase, putative
Type:Enzyme Catalytic Domain
Mol. Mass.:57248.42
Organism:Toxoplasma gondii
Description:n/a
Residue:507
Sequence:
MGQQESTLGGAAGEPRSRGHAAGTSGGPGDHLHATPGMFVQHSTAIFSDRYKGQRVLGKG
SFGEVILCKDKITGQECAVKVISKRQVKQKTDKESLLREVQLLKQLDHPNIMKLYEFFED
KGYFYLVGEVYTGGELFDEIISRKRFSEVDAARIIRQVLSGITYMHKNKIVHRDLKPENL
LLESKSKDANIRIIDFGLSTHFEASKKMKDKIGTAYYIAPEVLHGTYDEKCDVWSTGVIL
YILLSGCPPFNGANEYDILKKVEKGKYTFELPQWKKVSESAKDLIRKMLTYVPSMRISAR
DALDHEWIQTYTKEQISVDVPSLDNAILNIRQFQGTQKLAQAALLYMGSKLTSQDETKEL
TAIFHKMDKNGDGQLDRAELIEGYKELMRMKGQDASMLDASAVEHEVDQVLDAVDFDKNG
YIEYSEFVTVAMDRKTLLSRERLERAFRMFDSDNSGKISSTELATIFGVSDVDSETWKSV
LSEVDKNNDGEVDFDEFQQMLLKLCGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50345738
NameBDBM50345738
Synonyms:1-isopropyl-3-(naphthalen-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine | CHEMBL1241489 | CHEMBL2069956 | US9765037, Compound 7p
TypeSmall organic molecule
Emp. Form.C18H17N5
Mol. Mass.303.3611
SMILESCC(C)n1nc(-c2ccc3ccccc3c2)c2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a