Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium-dependent protein kinase 1 (CDPK1)
LigandBDBM50389693
Substrate/Competitorn/a
Meas. Tech.Biological Assay
IC50 6.70±n/a nM
Citation Van Voorhis, WCHol, WGLarson, ETMaly, DJMerritt, EOjo, KK Compositions and methods for treating toxoplasmosis, cryptosporidiosis, and other apicomplexan protozoan related diseases US Patent US9765037 Publication Date 9/19/2017
More Info.:Get all data from this article,  Assay Method
 
Calcium-dependent protein kinase 1 (CDPK1)
Name:Calcium-dependent protein kinase 1 (CDPK1)
Synonyms:n/a
Type:Protein
Mol. Mass.:76617.33
Organism:Cryptosporidium parvum
Description:Q6S4W0
Residue:677
Sequence:
MLNIEQNADECAKRVGANMVPVLHNVTEECNIKAEEKEIVPEVEEAKSESNNCLDSDDYL
EGHIYAAMCTKCAGELQQKLNPTEPYRDPKKVSGKEQISRGLIIESKSFVDANKNIKFSK
RSDKNEYAGLCSSPEVTTPNGERETSTDSNIKNTESTKVSHGIFDRTCLIQEHALVNRNI
NDFYELNLGNLGRGSYGSVVKAIDKQSGAQRAVKIILKPKLENINRLKREILIMKRLDHP
NIIKLFEVFEDTNYLYFVMEICTGGELFDRIIKRGHFSERYAAVIMRQVFSAIAYCHSNE
FMHRDLKPENLLFSDSSPNSLLKVIDWGFAAKCPKTHKFTSVVGTPYYVAPEVLYGSYSK
LCDLWSAGVILYILLCGYPPFHGKDNVEILRKVKIGQYSLEHNSWKYVSDSAKDLIKRLL
MTDPNKRISAQDALNHPWIKSQISSPNTADATYFTNDVCNSLLARFRDFQRQSKLKKLAL
TCVAYHLNDADIGALQKLFSTLDRNGDGVLTINEIRSALHKIQNVSQLGDDIDNLLMELD
TDGNGRIDYTEFIAASIDHKLYEQESLCKAAFKVFDLDMDGRISPQELSRVLNITFLQEA
FEQSTIDSLLKEVDINQDGYIDFNEFMKMMMGDKHEQKLETKVQKIEDEGSGNKKLSKGG
IISDIFGATSIFKKLNN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50389693
NameBDBM50389693
Synonyms:CHEMBL2070059 | US9765037, Compound 44
TypeSmall organic molecule
Emp. Form.C25H30N6O
Mol. Mass.430.5453
SMILESCC(C)COc1ccc2cc(ccc2c1)-c1nn(CC2CCNCC2)c2ncnc(N)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a