Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpidermal growth factor receptor (T790M/L858R)
LigandBDBM202386
Substrate/Competitorn/a
IC50 20.0±n/a nM
Citation Lee, KNiu, DPetter, RCSingh, J Heteroaryl compounds and uses thereof US Patent US9765038 Publication Date 9/19/2017
More Info.:Get all data from this article,  Assay Method
 
Epidermal growth factor receptor (T790M/L858R)
Name:Epidermal growth factor receptor (T790M/L858R)
Synonyms:n/a
Type:Receptor Kinase Domain
Mol. Mass.:128584.06
Organism:Homo sapiens (Human)
Description:n/a
Residue:1160
Sequence:
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS
INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAW
PENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLC
YANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVS
RGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPH
CVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGM
VGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKET
EFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVD
NPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLED
RRLVHRDLAARNVLVKTPQHVKITDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRI
YTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKC
WMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDV
VDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYS
SDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHS
TAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGS
TAENAEYLRVAPQSSEFIGA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM202386
NameBDBM202386
Synonyms:US10081606, Compound I-18 | US9238629, I-18 | US9765038, Compound I-18
TypeSmall organic molecule
Emp. Form.C20H18ClN5O2
Mol. Mass.395.842
SMILESCOc1ccccc1Nc1ncc(Cl)c(Nc2cccc(NC(=O)C=C)c2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a