Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1)
LigandBDBM340798
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 26.0±n/a nM
Citation Kiso, TTsukamoto, M Therapeutic agent for pain US Patent US9765040 Publication Date 9/19/2017
More Info.:Get all data from this article,  Assay Method
 
11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1)
Name:11-beta-Hydroxysteroid Dehydrogenase 1 (11-beta-HSD1)
Synonyms:11-DH | 11-beta-HSD1 | 11-beta-hydroxysteroid dehydrogenase 1 | Corticosteroid 11-beta-dehydrogenase isozyme 1 | Corticosteroid 11-beta-dehydrogenase isozyme 1 (11-beta-HSD-1)
Type:Enzyme
Mol. Mass.:31889.48
Organism:Rattus norvegicus (rat)
Description:P16232
Residue:288
Sequence:
MKKYLLPVLVLCLGYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLT
ARSEEGLQKVVSRCLELGAASAHYIAGTMEDMAFAERFVVEAGKLLGGLDMLILNHITQT
TMSLFHDDIHSVRRSMEVNFLSYVVLSTAALPMLKQSNGSIAIISSMAGKMTQPLIASYS
ASKFALDGFFSTIRKEHLMTKVNVSITLCVLGFIDTETALKETSGIILSQAAPKEECALE
IIKGTVLRKDEVYYDKSSWTPLLLGNPGRRIMEFLSLRSYNRDLFVSN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM340798
NameBDBM340798
Synonyms:US9765040, Compound 9
TypeSmall organic molecule
Emp. Form.C21H21F3N4O2
Mol. Mass.418.4122
SMILESCC(C)n1c(nnc1C(C)(C)Oc1c(F)cc(F)cc1F)-c1ccc(cc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a