Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetACT1
LigandBDBM65516
Substrate/Competitorn/a
Meas. Tech.Liquid growth assay
Temperature303.15±0 K
IC50 16700±0.0 nM
Citation Filipuzzi, IThomas, JRPries, VEstoppey, DSalcius, MStuder, CSchirle, MHoepfner, D Direct Interaction of Chivosazole F with Actin Elicits Cell Responses Similar to Latrunculin A but Distinct from Chondramide. ACS Chem Biol12:2264-2269 (2017) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
ACT1
Name:ACT1
Synonyms:Actin
Type:Protein
Mol. Mass.:41683.13
Organism:Baker's yeast
Description:P60010
Residue:375
Sequence:
MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS
KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMT
QIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDL
AGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSY
ELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS
GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQ
EYDESGPSIVHHKCF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65516
NameBDBM65516
Synonyms:CHEBI:84382 | CHEMBL2426321 | Chondramide C | SCHEMBL15752251
TypeSmall organic molecule
Emp. Form.C35H44N4O6
Mol. Mass.616.7471
SMILESC[C@H]1OC(=O)C[C@@H](NC(=O)[C@@H](Cc2c[nH]c3ccccc23)N(C)C(=O)[C@H](C)NC(=O)[C@@H](C)C\C(C)=C\[C@H]1C)c1ccc(O)cc1 |t:36|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a