Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcGMP-dependent 3',5'-cyclic phosphodiesterase
LigandBDBM204686
Substrate/Competitorn/a
Meas. Tech.Inhibition of Recombinant PDE2A
IC50 3.00±n/a nM
Citation Lankau, HLangen, BGrunwald, CHoefgen, NStange, HDost, REgerland, U (1,2,4)triazolo[4,3-A]quinoxaline derivatives as inhibitors of phosphodiesterases US Patent US9540379 Publication Date 1/10/2017
More Info.:Get all data from this article,  Assay Method
 
cGMP-dependent 3',5'-cyclic phosphodiesterase
Name:cGMP-dependent 3',5'-cyclic phosphodiesterase
Synonyms:CGS-PDE | Cyclic GMP-stimulated phosphodiesterase | PDE2A | cGSPDE
Type:Protein
Mol. Mass.:105691.58
Organism:Homo sapiens (Human)
Description:O00408
Residue:941
Sequence:
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDI
SGLQRAVKEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCN
GLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAV
EKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDL
DASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVV
EDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTD
EDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNF
ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM204686
NameBDBM204686
Synonyms:8-bromo-1-(5-butoxy-2-fluoro-phenyl)-4-methyl-[1,2,4]triazolo[4,3-a]quinoxaline | US9540379, 84
TypeSmall organic molecule
Emp. Form.C20H18BrFN4O
Mol. Mass.429.286
SMILESCCCCOc1ccc(F)c(c1)-c1nnc2c(C)nc3ccc(Br)cc3n12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a