Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM772
Substrate/CompetitorBDBM13790
Meas. Tech.Enzyme Assay and Determination of the Inhibition Constants
pH7.4±n/a
Temperature295.15±n/a K
Ki 21000±2000 nM
Citation Katz, BAMackman, RLuong, CRadika, KMartelli, ASprengeler, PAWang, JChan, HWong, L Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator. Chem Biol7:299-312 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Trypsin
Name:Trypsin I
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM772
NameBDBM772
Synonyms:Benzamidine | CHEMBL79897 | [amino(phenyl)methylidene]azanium | benzamidine deriv. | benzamidinium chloride
Typen/a
Emp. Form.C7H9N2
Mol. Mass.121.1592
SMILESNC(=[NH2+])c1ccccc1
Structure
BDBM13790
NameBDBM13790
Synonyms:6-amino-2-[(1-{2-[(4-methylbenzene)sulfonamido]acetyl}pyrrolidin-2-yl)formamido]-N-(4-nitrophenyl)hexanamide; acetic acid | Chromogenic Substrate | Chromozym-PL | Tosyl-Gly-Pro-Lys-pNA | Tosyl-glycyl-polyl-lysine-4-nitranilide-acetate | Trypsin/Thrombin Chromogenic Substrate | Trypsin/Thrombin/Plasmin Chromogenic Substrate | Trypsin/Thrombin/Tryptase Chromogenic Substrate
TypeSmall Organic Molecule
Emp. Form.C26H34N6O7S
Mol. Mass.574.649
SMILESCc1ccc(cc1)S(=O)(=O)NCC(=O)N1CCCC1C(=O)NC(CCCCN)C(=O)Nc1ccc(cc1)[N+]([O-])=O
Structure