Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTryptase
LigandBDBM14320
Substrate/CompetitorBDBM14298
Meas. Tech.Enzyme Assay and Determination of the Inhibition Constants
Ki 390000±n/a nM
Citation McGrath, MESprengeler, PAHirschbein, BSomoza, JRLehoux, IJanc, JWGjerstad, EGraupe, MEstiarte, AVenkataramani, CLiu, YYee, RHo, JDGreen, MJLee, CSLiu, LTai, VSpencer, JSperandio, DKatz, BA Structure-guided design of peptide-based tryptase inhibitors. Biochemistry45:5964-73 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Tryptase
Name:Tryptase
Synonyms:Tryptase II | Tryptase beta-1 | Tryptase beta-2 | Tryptase-2
Type:PROTEIN
Mol. Mass.:30518.79
Organism:Homo sapiens (Human)
Description:ChEMBL_210702
Residue:275
Sequence:
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14320
NameBDBM14320
Synonyms:1-amino-isoquinoline | CHEMBL62083 | Fragment 17 | fragment 1 (J. med. chem.,50,1116) | isoquinolin-1-amine
TypeSmall organic molecule
Emp. Form.C9H8N2
Mol. Mass.144.1732
SMILESNc1nccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM14298
NameBDBM14298
Synonyms:Tosyl-Gly-Pro-Lys-pNA | Tryptase/Trypsin Chromogenic Substrate
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure