Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTryptophan 5-monooxygenase 1
LigandBDBM341431
Substrate/Competitorn/a
Meas. Tech.Biochemical In Vitro Assay
IC50 4.00±n/a nM
Citation Bur, DGrisostomi, CNayler, ORemen, LVercauteren, MWelford, R Tricyclic piperidine compounds US Patent US9765092 Publication Date 9/19/2017
More Info.:Get all data from this article,  Assay Method
 
Tryptophan 5-monooxygenase 1
Name:Tryptophan 5-hydroxylase_UNCURATED
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:50990.64
Organism:Homo sapiens (Human)
Description:ChEMBL_1361824
Residue:444
Sequence:
MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEF
EIFVDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCAN
RVLMYGSELDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQE
LNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRD
FLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGA
SEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITC
KQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSA
MNELQHDLDVVSDALAKVSRKPSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM341431
NameBDBM341431
Synonyms:2-((2-chloro-5-fluoro-6-morpholinopyridin-3-yl)oxy)-1-(5-(5-cyclopropyl-3-fluoropyridin-2-yl)-2-methyl-7,8-dihydro-[1,3,4]thiadiazolo[2',3':2,3]imidazo[4,5-c]pyridin-6(5H)-yl)ethanone | US9765092, Example 1.14.9
TypeSmall organic molecule
Emp. Form.C27H26ClF2N7O3S
Mol. Mass.602.055
SMILESCc1nn2c3C(N(CCc3nc2s1)C(=O)COc1cc(F)c(nc1Cl)N1CCOCC1)c1ncc(cc1F)C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a